HPA028656

GBP5 antibody from Atlas Antibodies
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA028656
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA028656, RRID:AB_10601471
Product name
Anti-GBP5
Provider product page
Atlas Antibodies - HPA028656
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TDQALTETEKKKKEAQVKAEAEKAEAQRLAAIQRQ
NEQMMQERERLHQEQVRQMEIAKQNWLAEQQKMQE
QQMQEQAAQLSTTFQAQNRSLLSELQHAQRTVNND
DPCVLL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -