Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000389-M06 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000389-M06, RRID:AB_1111679
- Product name
- RHOC monoclonal antibody (M06), clone 1B7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant RHOC.
- Antigen sequence
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYV
PTVFENYIADIEVDGKQVELALWDTAGQEDYDRLR
PLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKH
FCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVR
SEEGRDMANRISAFGYLECSAKTKEGVREVFEMAT
RAGLQVRKNKRRRGCPIL- Isotype
- IgG
- Antibody clone number
- 1B7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Rhos and Rho kinases in the rat prostate: their possible functional roles and distributions.
Saito M, Ohmasa F, Shomori K, Dimitriadis F, Ohiwa H, Shimizu S, Tsounapi P, Kinoshita Y, Satoh K
Molecular and cellular biochemistry 2011 Dec;358(1-2):207-13
Molecular and cellular biochemistry 2011 Dec;358(1-2):207-13
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- RHOC monoclonal antibody (M06), clone 1B7. Western Blot analysis of RHOC expression in NIH/3T3 ( Cat # L018V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- RHOC monoclonal antibody (M06), clone 1B7. Western Blot analysis of RHOC expression in PC-12(Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged RHOC is 3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to RHOC on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol