Explore
Validate
Learn
ELISAAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001745-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001745-M01, RRID:AB_565650
- Product name
- DLX1 monoclonal antibody (M01), clone 2H3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant DLX1.
- Antigen sequence
YLALPERAELAASLGLTQTQVKIWFQNKRSKFKKL
MKQGGAALEGSALANGRALSAGSPPVPPGWNPNSS
SGKGSGGNAGSYIPSYTSWYPSAHQEAMQQPQLM- Isotype
- IgG
- Antibody clone number
- 2H3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Up-regulation of homeodomain genes, DLX1 and DLX2, by FLT3 signaling.
Starkova J, Gadgil S, Qiu YH, Zhang N, Hermanova I, Kornblau SM, Drabkin HA
Haematologica 2011 Jun;96(6):820-8
Haematologica 2011 Jun;96(6):820-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged DLX1 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to DLX1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of DLX1 transfected lysate using anti-DLX1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with DLX1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
