Antibody data

Product number
H00010228-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010228-M01, RRID:AB_425834
Product name
STX6 monoclonal antibody (M01), clone 1G2
Provider product page
Abnova Corporation - H00010228-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant STX6.
Antigen sequence
MSMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDP
STATREEIDWTTNELRNNLRSIEWDLEDLDETISI
VEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQ
MSTSSVQALAERKNRQALLGDSGSQNWSTGTTDKY
GRLDRELQRANSHFIEEQQAQQQLIVEQQDEQLEL
VSGSIGVLKNMSQRIGGELEEQAVMLEDFSHELES
TQSRLDNVMKKLAKVSHMTSDRRQWCAIAILFAVL
LVVLILFLVL
Isotype
IgG
Antibody clone number
1G2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -