HPA014391

antibody from Atlas Antibodies

Targeting: MS4A1 B1, Bp35, CD20, MS4A2

Antibody data

Submit

Validation data

Product number: HPA014391 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA014391, RRID:AB_1846264
Product name: Anti-MS4A1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: MESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYC Y
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

MS4A1 protein structure - HPA014391 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human tonsil and cerebral cortex tissues using Anti-MS4A1 antibody. Corresponding MS4A1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, lymph node, spleen and testis using Anti-MS4A1 antibody HPA014391 (A) shows similar protein distribution across tissues to independent antibody HPA014341 (B).
Antibody #2 product nr: HPA014341
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human spleen using Anti-MS4A1 antibody HPA014391.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-MS4A1 antibody HPA014391.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-MS4A1 antibody HPA014391.
Sample type: HUMAN