Antibody data

Product number
H00023495-M25
Provider
Abnova Corporation
Product name
TNFRSF13B monoclonal antibody (M25), clone 4G4
Provider product page
Abnova Corporation - H00023495-M25
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant TNFRSF13B.
Antigen sequence
SGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPE
EQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSC
RKEQGKFYDHLLRDCISCASICGQHPKQCAYFCEN
KLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEH
RGSEASPALPGLKLSADQVALVYS
Isotype
IgG
Antibody clone number
4G4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -