HPA030453

TNFRSF13B antibody from Sigma-Aldrich
CD267, IGAD2, TACI
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030453
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA030453, RRID:AB_10601700
Product name
Anti-TNFRSF13B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA030453
Antibody type
Polyclonal
Antigen
tumor necrosis factor receptor superfamily, member 13B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ACFLKKRGDPCSCQPRSRPRQSPAKSSQDHAMEAG
SPVSTSPEPVETCSFCFPECRAPTQESAVTPGTPD
PTCAGRWGCHTRTTVLQPCPHIPDSGLGIVCVPAQ
E
Storage
-20C
Provider Type Product Number
- No reagents -