HPA019472

antibody from Atlas Antibodies

Targeting: SST SMST

Western blot (Supportive data in Antibodypedia)

Immunohistochemistry (Enhanced validation)

Antibody Data

Product number

HPA019472

Provider

Atlas Antibodies

Proper citation

Atlas Antibodies Cat#HPA019472, RRID:AB_1857360

Product name

Anti-SST

Antibody type

Polyclonal

Reactivity

Human, Mouse

Host

Rabbit

Conjugate

Unconjugated

Antigen sequence

APSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSE
PNQTENDALEPEDLSQAAEQDEMRLELQRSANSNP
AMAPRERKAGCKN


Isotype

IgG

Vial size

100 µl

Storage

Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Western blot

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Western blot analysis in control (vector only transfected HEK293T lysate) and SST over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY420765).

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Western blot analysis in human stomach tissue.

Immunohistochemistry

Enhanced validation

Submitted by

Atlas Antibodies (provider)

Enhanced method

Orthogonal validation

Main image

Experimental details

Immunohistochemistry analysis in human cerebral cortex and tonsil tissues using HPA019472 antibody. Corresponding SST RNA-seq data are presented for the same tissues.

Sample type

HUMAN

Orthogonal method

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Show more

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human stomach shows strong positivity in enteroendocrine cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse hypothalamus shows immunopositive processes in the central anterior hypothalamic area.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cerebral cortex shows selective positivity in subsets of neurons.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse lateral septum shows immunoreactivity in a subset of neurons.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse stria terminalis shows selective positivity in neuronal processes.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse hippocampus shows immunoreactivity in a subset of interneurons in the CA2/ stratum oriens.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse piriform area shows positivity in a subset of interneuron-like cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human lateral ventricle wall shows cytoplasmic immunoreactivity in single neurons.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cerebral cortex shows cytoplasmic positivity in single neurons.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse brain shows strong positivity in a subset of neurons in the cerebral cortex.

Sample type

MOUSE

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse dentate gyrus shows moderate to strong positivity in a subset of neurons in the polymorph layer.

Sample type

MOUSE

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons, as well as immunoreactivity in neural processes.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in neuroendocrine cells.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in a subset of cells in islets of Langerhans.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected.

Sample type

HUMAN