WH0001364M1

CLDN4 antibody from Sigma-Aldrich
CPE-R, CPETR, CPETR1, hCPE-R, WBSCR8
ELISA
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
WH0001364M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0001364M1, RRID:AB_1840752
Product name
Monoclonal Anti-CLDN4 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0001364M1
Antibody type
Monoclonal
Antigen
CLDN4 (NP_001296, a.a. 29-79) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQ
CKVYDSLLALPQDLQ* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -