HPA061003

antibody from Atlas Antibodies

Targeting: TH DYT5b

Western blot (Supportive data in Antibodypedia)

Immunohistochemistry (Enhanced validation)

Antibody Data

Product number

HPA061003

Provider

Atlas Antibodies

Proper citation

Atlas Antibodies Cat#HPA061003, RRID:AB_2630374

Product name

Anti-TH

Antibody type

Polyclonal

Reactivity

Human, Mouse

Host

Rabbit

Conjugate

Unconjugated

Antigen sequence

SESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDV
LDSPQAVRRSLEGVQDELDTLAHALSAIG


Isotype

IgG

Vial size

100 µl

Storage

Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Western blot

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Adrenal Gland tissue

Immunohistochemistry

Enhanced validation

Submitted by

Atlas Antibodies (provider)

Enhanced method

Orthogonal validation

Main image

Experimental details

Immunohistochemistry analysis in human adrenal gland and stomach tissues using HPA061003 antibody. Corresponding TH RNA-seq data are presented for the same tissues.

Sample type

HUMAN

Orthogonal method

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Show more

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human lateral ventricle shows positivity in neuropil.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse caudate putamen shows synaptic immunoreactivity.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human lateral ventricle shows strong positivity in neuropil.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse olfactory bulb shows immunoreactivity in the glomerular layer.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse basal forebrain shows positivity in the core of nucleus accumbens.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse hypothalamus shows immunoreactivity in a subset of neurons in the paraventricular nucleus.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse hindbrain shows positivity in the locus coeruleus.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human lateral ventricle wall shows strong immunoreactivity in neural fibers.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cerebral cortex shows positivity in scattered neural fibers.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of adrenal gland shows strong cytoplasmic positivity in medullary cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human caudate shows moderate positivity in neuropil.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human stomach shows no positivity in glandular cells as expected.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse caudate putamen shows synaptic immunoreactivity.

Sample type

MOUSE

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse hindbrain shows positivity in the locus coeruleus.

Sample type

MOUSE

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse amygdala shows positive processes

Sample type

MOUSE

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse midbrain shows positive processes and cell bodies.

Sample type

MOUSE

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse hypothalamus shows immunoreactivity in a subset of neurons in the paraventricular nucleus.

Sample type

MOUSE