WH0001487M1

CTBP1 antibody from MilliporeSigma / Merck KGaA
BARS
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
WH0001487M1
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0001487M1, RRID:AB_1841044
Product name
Monoclonal Anti-CTBP1 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0001487M1
Antibody type
Monoclonal
Antigen
CTBP1 (AAH53320, a.a. 1-430) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MSGVRPPIMNGPLHPRPLVALLDGRDCTVEMPILK
DVATVAFCDAQSTQEIHEKVLNEAVGALMYHTITL
TREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIA
VCNVPAASVEETADSTLCHILNLYRRATWLHQALR
EGTRVQSVEQIREVASGAARIRGETLGIIGLGRVG
QAVALRAKAFGFNVLFYDPYLSDGVERALGLQRVS
TLQDLLFHSDCVTLHCGLNEHNHHLINDFTVKQMR
QGAFLVNTAR (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -