HPA063903

APBB1IP antibody from Atlas Antibodies
INAG1, RIAM
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA063903
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA063903, RRID:AB_2685147
Product name
Anti-APBB1IP
Provider product page
Atlas Antibodies - HPA063903
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KTLYDNYQRAVAKAGLASRWTNLGTVNAAAPAQPS
TGPKTGTTQPNGQIPQATHSVSAVLQEAQRHAETS
KDKKPAL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -