HPA036521

antibody from Atlas Antibodies

Targeting: HOMER1 HOMER-1B, SYN47, Ves-1

Antibody data

Submit

Validation data

Product number: HPA036521 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA036521, RRID:AB_2675170
Product name: Anti-HOMER1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: MELTSTPSQESAGGDLQSPLTPESINGTDDERTPD VTQNSEPRAEPTQNALPFSHSSAISKHWEAELATL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

HOMER1 protein structure - HPA036521 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-HOMER1 antibody. Corresponding HOMER1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, heart muscle and pancreas using Anti-HOMER1 antibody HPA036521 (A) shows similar protein distribution across tissues to independent antibody HPA036522 (B).
Antibody #2 product nr: HPA036522
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human heart muscle using Anti-HOMER1 antibody HPA036521.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-HOMER1 antibody HPA036521.
Sample type: HUMAN