HPA050640

antibody from Atlas Antibodies

Targeting: IGFBP1 AFBP, hIGFBP-1, IBP1, IGF-BP25, PP12

Antibody data

Submit

Validation data

Product number: HPA050640 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA050640, RRID:AB_2681197
Product name: Anti-IGFBP1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: SKALHVTNIKKWKEPCRIELYRVVESLAKAQETSG EEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWC VYPWNGKRIPGSPEIRGDPNCQI
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

IGFBP1 protein structure - HPA050640 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human placenta and prostate tissues using Anti-IGFBP1 antibody. Corresponding IGFBP1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, kidney, placenta and testis using Anti-IGFBP1 antibody HPA050640 (A) shows similar protein distribution across tissues to independent antibody HPA046972 (B).
Antibody #2 product nr: HPA046972
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-IGFBP1 antibody HPA050640.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-IGFBP1 antibody HPA050640.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-IGFBP1 antibody HPA050640.
Sample type: HUMAN