HPA041940

PRKCSH antibody from Atlas Antibodies
G19P1, GIIB, PCLD, PLD1, VASAP-60
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA041940
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA041940, RRID:AB_2677758
Product name
Anti-PRKCSH
Provider product page
Atlas Antibodies - HPA041940
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SPAEEDKMPPYDEQTQAFIDAAQEARNKFEEAERS
LKDMEESIRNLEQEISFDFGPNGEFAYLYSQCYEL
TTNEYVYRLCPFKLVSQKPK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -