Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006890-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006890-M03, RRID:AB_1112161
- Product name
- TAP1 monoclonal antibody (M03), clone 3D10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TAP1.
- Antigen sequence
GSETRRLSLFLVLVVLSSLGEMAIPFFTGRLTDWI
LQDGSADTFTRNLTLMSILTIASAVLEFVGDGIYN
NTMGHVHSHLQGEVFGAVLRQETEFFQQNQTGNIM
SRVTE- Isotype
- IgG
- Antibody clone number
- 3D10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of TAP1 expression in transfected 293T cell line by TAP1 monoclonal antibody (M03), clone 3D10.Lane 1: TAP1 transfected lysate(87.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged TAP1 is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol