HPA027062

CASP14 antibody from Atlas Antibodies
MGC119078, MGC119079, MICE
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA027062
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027062, RRID:AB_2672101
Product name
Anti-CASP14
Provider product page
Atlas Antibodies - HPA027062
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RLALILCVTKAREGSEEDLDALEHMFRQLRFESTM
KRDPTAEQFQEELEKFQQAIDSREDPVSCAFVVLM
AHGREGFLKGEDGEMVKLENLFEALNNKNCQALRA
KPKVYIIQACRGEQRDPGETVGGDEIVM
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -