H00081876-A01

RAB1B antibody from Abnova Corporation
No application information provided.

Antibody data

Product number
H00081876-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00081876-A01, RRID:AB_462640
Product name
RAB1B polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00081876-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant RAB1B.
Antigen sequence
TDQESYANVKQWLQEIDRYASENVNKLLVGNKSDL
TTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQ
AFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKP
AGGGCC
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -