HPA035040

NR2C1 antibody from Atlas Antibodies
TR2, TR2-11

Antibody data

Product number
HPA035040
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA035040, RRID:AB_2674426
Product name
Anti-NR2C1
Provider product page
Atlas Antibodies - HPA035040
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QFILTNHDGSTPSKVILARQDSTPGKVFLTTPDAA
GVNQLFFTTPDLSAQHLQLLTDNSPDQGPNKV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -