Antibody data

Product number
ABIN311630
Provider
antibodies-online
Product name
anti-Sperm Associated Antigen 11B (SPAG11B) antibody
Provider product page
antibodies-online - ABIN311630
Antibody type
Polyclonal
Antigen
The immunogen for anti-SPAG11B antibody: synthetic peptide directed towards the N terminal of human SPAG11B
Reactivity
Human
Host
Rabbit
Antigen sequence
MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEA
LGELR ERAPGQGTNG
Vial size
50 µg
Provider Type Product Number
- No reagents -