PAB24440

SLC25A37 antibody from Abnova Corporation
HT015, MFRN, MFRN1, MSCP

Antibody data

Product number
PAB24440
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB24440, RRID:AB_11121550
Product name
SLC25A37 polyclonal antibody
Provider product page
Abnova Corporation - PAB24440
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant SLC25A37.
Antigen sequence
ARRMDGDSRDGGGGKDATGSEDYENLPTSASV
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -