Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005764-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005764-M02, RRID:AB_606884
- Product name
- PTN monoclonal antibody (M02), clone 2E3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PTN.
- Antigen sequence
SDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQT
MKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTA
LKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKP
QAESK- Isotype
- IgG
- Antibody clone number
- 2E3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of PTN expression in transfected 293T cell line by PTN monoclonal antibody (M02), clone 2E3.Lane 1: PTN transfected lysate(18.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to PTN on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol