Explore
Validate
LearnH00006929-M01
antibody from Abnova Corporation
Targeting: TCF3
bHLHb21, E2A, E47, ITF1, MGC129647, MGC129648, p75, VDIR
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006929-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006929-M01, RRID:AB_607159
- Product name
- TCF3 monoclonal antibody (M01), clone 5G2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TCF3.
- Antigen sequence
EREKERRVANNARERLRVRDINEAFKELGRMCQLH
LNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPK
AACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHN
PAGHM- Isotype
- IgG
- Antibody clone number
- 5G2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Synaptic cross-talk between N-methyl-D-aspartate receptors and LAPSER1-beta-catenin at excitatory synapses.
Schmeisser MJ, Grabrucker AM, Bockmann J, Boeckers TM
The Journal of biological chemistry 2009 Oct 16;284(42):29146-57
The Journal of biological chemistry 2009 Oct 16;284(42):29146-57
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- TCF3 monoclonal antibody (M01), clone 5G2 Western Blot analysis of TCF3 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged TCF3 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
