HPA029974

antibody from Atlas Antibodies

Targeting: FOXM1 FKHL16, HFH-11, HNF-3, INS-1, MPHOSPH2, MPP2, TGT3, trident

Antibody data

Submit

Validation data

Product number: HPA029974 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA029974, RRID:AB_10670030
Product name: Anti-FOXM1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: GIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEE IQPGEEMPHLARPIKVESPPLEEWPSPAPSFKEES SHSWEDSSQSPTPRPKKSYSGL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

FOXM1 protein structure - HPA029974 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human rectum and skeletal muscle tissues using HPA029974 antibody. Corresponding FOXM1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human breast shows strong nuclear and extracellular positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human rectum shows moderate nuclear positivity in a subset of glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows moderate nuclear positivity in few cells in seminiferous ducts.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human uterine cervix shows moderate nuclear positivity in a subset of epidermal cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected.
Sample type: HUMAN