HPA041797

antibody from Atlas Antibodies

Targeting: LYPD3 C4.4A

Antibody data

Submit

Validation data

Product number: HPA041797 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA041797, RRID:AB_2677679
Product name: Anti-LYPD3
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: DGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFS LAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQD RCNAKLNLTSRALDPAGN
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

LYPD3 protein structure - HPA041797 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human esophagus and skeletal muscle tissues using Anti-LYPD3 antibody. Corresponding LYPD3 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, kidney, liver and skin using Anti-LYPD3 antibody HPA041797 (A) shows similar protein distribution across tissues to independent antibody HPA041529 (B).
Antibody #2 product nr: HPA041529
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human oral mucosa shows strong cytoplasmic and membranous positivity in squamous epithelial cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin using Anti-LYPD3 antibody HPA041797.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human esophagus shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-LYPD3 antibody HPA041797.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-LYPD3 antibody HPA041797.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-LYPD3 antibody HPA041797.
Sample type: HUMAN