HPA037545

U2SURP antibody from Atlas Antibodies
fSAPa, SR140
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA037545
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA037545, RRID:AB_10672598
Product name
Anti-U2SURP
Provider product page
Atlas Antibodies - HPA037545
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EEELDGAPLEDVDGIPIDATPIDDLDGVPIKSLDD
DLDGVPLDATEDSKKNEPIFKVAPSKWEAVDESEL
EAQAVTTSKWEL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -