PAB23927

TMEM263 antibody from Abnova Corporation
C12orf23, MGC17943

Antibody data

Product number
PAB23927
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB23927, RRID:AB_11121404
Product name
C12orf23 polyclonal antibody
Provider product page
Abnova Corporation - PAB23927
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant C12orf23.
Antigen sequence
QQEIPSYLNDEPPEGSMKDHPQQQPGMLSR
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.