HPA003060

antibody from Atlas Antibodies

Targeting: ASB9 DKFZP564L0862, FLJ20636, MGC4954

Antibody data

Submit

Validation data

Product number: HPA003060 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA003060, RRID:AB_1078225
Product name: Anti-ASB9
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: SVQPESDLASPIHEAARRGHVECVNSLIAYGGNID HKISHLGTPLYLACENQQRACVKKLLESGADVNQG KGQDSPLHAVARTASEELACLLMDFGADTQAKNAE GKRPVELVPPESPLAQLFLEREGA
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ASB9 protein structure - HPA003060 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and endometrium tissues using Anti-ASB9 antibody. Corresponding ASB9 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, kidney, pancreas and testis using Anti-ASB9 antibody HPA003060 (A) shows similar protein distribution across tissues to independent antibody HPA003014 (B).
Antibody #2 product nr: HPA003014
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas using Anti-ASB9 antibody HPA003060.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-ASB9 antibody HPA003060.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-ASB9 antibody HPA003060.
Sample type: HUMAN