HPA061023

C15orf41 antibody from Atlas Antibodies
FLJ22851, HH114, MGC11326
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA061023
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA061023, RRID:AB_2684417
Product name
Anti-C15orf41
Provider product page
Atlas Antibodies - HPA061023
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TKAQYDEIAQCLVSVPPTRQSLRKLKQRFPSQSQA
TLLSIFSQEYQKHIKRTHAKHHTSEAIESYYQRYL
NGVVKNGAAPVLLDLA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -