Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023327-M04 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023327-M04, RRID:AB_804991
- Product name
- NEDD4L monoclonal antibody (M04), clone 1D2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NEDD4L.
- Antigen sequence
MATGLGEPVYGLSEDEGESRILRVKVVSGIDLAKK
DIFGASDPYVKLSLYVADENRELALVQTKTIKKTL
NPKWNEEFYFRVNPSNHRLLFEVFDENRLT- Isotype
- IgG
- Antibody clone number
- 1D2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of NEDD4L expression in transfected 293T cell line by NEDD4L monoclonal antibody (M04), clone 1D2.Lane 1: NEDD4L transfected lysate (Predicted MW: 104.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged NEDD4L is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of NEDD4L transfected lysate using anti-NEDD4L monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NEDD4L monoclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol