H00064434-B01P

NOM1 antibody from Abnova Corporation
C7orf3, PPP1R113, SGD1
No application information provided.

Antibody data

Product number
H00064434-B01P
Provider
Abnova Corporation
Product name
NOM1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00064434-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human NOM1 protein.
Antigen sequence
MAASRSAGEAGPGGSQGRVVRMKRRGGRGPRRGPA
GGGEKALKRLKLAVEEFVHATSEGEAPGGCEGRGA
PVSFRPGGRKSRKELRKEKRHLRKARRLQRTAGPE
QGPGLGGRSGAEEASGHRQDTEERARPAPSRDPSP
PRKPRPSRVKAKATAATAKTRPSAAATAAARKRAL
LAANEEEDREIRKLERCLGLNKRKKKDGSSSVPLS
FARDGLDYILGALESGKNSGLYDSSGEEEEDAGQT
LPESDLESDSQDESEEEEEGDVEKEKKAQEAEAQS
EDDDEDTEEEQGEEKEKGAQEKRRGKRVRFAEDEE
KSENSSEDGDITDKSLCGSGEKYIPPHVRQAEETV
DFKKKEELERLKKHVKGLLNRLSEPNMASISGQLE
ELYMAHSRKDMNDTLTSALMGACVTASAMPSRLMM
EHVLLVSILHHTVGIEVGAHFLEAVVRKFDAIYKY
GSEGKECDNLFTVIAHLYNFHVVQSLLIFDILKKL
IGTFTEKDIELILLMLKNVGFSLRKDDALSLKELI
TEAQTKASGAGSEFQDQTRIRFMLETMLALKNNDM
RKIPGYDPEPVEKLRKLQRALVRNAGSGSETQLRV
SWDSVLSAEQTGRWWIVGSAWSGAPMIDNSHHTHL
QKQLVGTVSSKILELARKQRMNTDIRRNIFCTIMT
SEDFLDAFEKLLKLGLKDQQEREIIHVLMDCCLQE
KTYNPFYAFLASKFCEYERRFQMTFQFSIWDKFRD
LENLPATNFSNLVHLVAHLLKTKSLSLSILKVVEF
SELDKPRVRFLRKVLSILLMETEVEDLSLIFTRVS
DNPKLGVLREGLKLFISHFLLKNAQAHRSADEANV
LREKADLATKCLQGKASLRM
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.