H00003959-D01

LGALS3BP antibody from Abnova Corporation
90K, BTBD17B, CyCAP, gp90, M2BP, MAC-2-BP, TANGO10B

Antibody data

Product number
H00003959-D01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003959-D01, RRID:AB_10719306
Product name
LGALS3BP MaxPab rabbit polyclonal antibody (D01)
Provider product page
Abnova Corporation - H00003959-D01
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human LGALS3BP protein.
Antigen sequence
MTPPRLFWVWLLVAGTQGVNDGDMRLADGGATNQG
RVEIFYRGQWGTVCDNLWDLTDASVVCRALGFENA
TQALGRAAFGQGSGPIMLDEVQCTGTEASLADCKS
LGWLKSNCRHERDAGVVCTNETRSTHTLDLSRELS
EALGQIFDSQRGCDLSISVNVQGEDALGFCGHTVI
LTANLEAQALWKEPGSNVTMSVDAECVPMVRDLLR
YFYSRRIDITLSSVKCFHKLASAYGARQLQGYCAS
LFAILLPQDPSFQMPLDLYAYAVATGDALLEKLCL
QFLAWNFEALTQAEAWPSVPTDLLQLLLPRSDLAV
PSELALLKAVDTWSWGERASHEEVEGLVEKIRFPM
MLPEELFELQFNLSLYWSHEALFQKKTLQALEFHT
VPFQLLARYKGLNLTEDTYKPRIYTSPTWSAFVTD
SSWSARKSQLVYQSRRGPLVKYSSDYFQAPSDYRY
YPYQSFQTPQHPSFLFQDKRVSWSLVYLPTIQSCW
NYGFSCSSDELPVLGLTKSGGSDRTIAYENKALML
CEGLFVADVTDFEGWKAAIPSALDTNSSKSTSSFP
CPAGHFNGFRTVIRPFYLTNSSGVD
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -