Antibody data
- Product number
- AMAb91234
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb91234, RRID:AB_2665857
- Product name
- Anti-THSD7A
- Provider product page
- Atlas Antibodies - AMAb91234
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
VCQSSPCEAEELRYSLHVGPWSTCSMPHSRQVRQA
RRRGKNKEREKDRSKGVKDPEARELIKKKRNRNRQ
NRQENKYWDIQIGYQTREVMCINKTGKAADLSFCQ
QEKLPMTFQSC
- Epitope
- Binds to an epitope located within the peptide sequence PCEAEELRYSLHVGP as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL3779
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human kidney and skeletal muscle tissues using AMAb91234 antibody. Corresponding THSD7A RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Show more
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows membranous immunoreactivity in the glomerulus and a subset of tubules.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows membranous positivity in Leydig cells.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows absence of immunoreactivity (negative control).
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows moderate membranous positivity in cells in glomeruli, as well as in a subset of renal tubules.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate membranous positivity in Leydig cells.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Explore
Validate
Learn
