Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00026508-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00026508-M02, RRID:AB_606376
- Product name
- HEYL monoclonal antibody (M02), clone 4A11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HEYL.
- Antigen sequence
PLRRATGIILPARRNVLPSRGASSTRRARPLERPA
TPVPVAPSSRAARSSHIAPLLQSSSPTPPGPTGSA
AYVAVPTPNSSSPGPAGRPAGAMLYHSWVSEITEI
GA- Isotype
- IgG
- Antibody clone number
- 4A11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Epigenetic inactivation of transforming growth factor-β1 target gene HEYL, a novel tumor suppressor, is involved in the P53-induced apoptotic pathway in hepatocellular carcinoma.
Kuo KK, Jian SF, Li YJ, Wan SW, Weng CC, Fang K, Wu DC, Cheng KH
Hepatology research : the official journal of the Japan Society of Hepatology 2015 Jul;45(7):782-93
Hepatology research : the official journal of the Japan Society of Hepatology 2015 Jul;45(7):782-93
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HEYL monoclonal antibody (M02), clone 4A11 Western Blot analysis of HEYL expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HEYL monoclonal antibody (M02), clone 4A11. Western Blot analysis of HEYL expression in LNCaP ( Cat # L004V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged HEYL is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to HEYL on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
