HPA055167

TMEM151B antibody from Atlas Antibodies
bA444E17.5, C6orf137, TMEM193

Antibody data

Product number
HPA055167
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA055167, RRID:AB_2682723
Product name
Anti-TMEM151B
Provider product page
Atlas Antibodies - HPA055167
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CWHCQARHELQHRVDVSSVRERVGRMQQATPCIWW
KAISYH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.