H00257044-B01P

CATSPERE antibody from Abnova Corporation
C1orf101, MGC33370
No application information provided.

Antibody data

Product number
H00257044-B01P
Provider
Abnova Corporation
Product name
C1orf101 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00257044-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C1orf101 protein.
Antigen sequence
MSAREVAVLLLWLSCYGSALWRYSTNSPNYRIFST
RSTIKLEYEGTLFTEWSVPETCFVLNKSSPTTELR
CSSPGVHAIKPIVTGPDEEERYLFVESSHTCFLWY
YRVRHFFNNFTQLITVWAYDPESADPDELLGNAEE
PSINSIVLSTQMATLGQKPVIHTVLKRKVYSSNEK
MRRGTWRIVVPMTKDDALKEIRGNQVTFQDCFIAD
FLILLTFPLLTIPEIPGYLPISSPRGSQLMASWDA
CVVASAVLVTDMETFHTTDSFKSWTRIRVPPDILS
DDERRSVAHVILSRDGIVFLINGVLYIKSFRGFIR
LGGIVNLPDGGITGISSRKWCWVNYLLKAKGRRST
FAVWTENEIYLGSILLKFARLVTTTELKNILSLSV
TATLTIDRVEYTGHPLEIAVFLNYCTVCNVTKKIF
LVIYNEDTKQWVSQDFTLDAPIDSVTMPHFTFSAL
PGLLLWNKHSIYYCYHNFTFTGILQTPAGHGNLSM
LSNDSIIHEVFIDYYGDILVKMENNVIFYSKINTR
DAVKLHLWTNYTTRAFIFLSTSGQTYFLYALDDGT
IQIQDYPLHLEAQSIAFTTKDKCPYMAFHNNVAHV
FYFLDKGEALTVWTQIVYPENTGLYVIVESYGPKI
LQESHEISFEAAFGYCTKTLTLTFYQNVDYERISD
YFETQDKHTGLVLVQFRPSEYSKACPIAQKVFQIA
VGCDDKKFIAIKGFSKKGCHHHDFSYVIEKSYLRH
QPSKNLRVRYIWGEYGCPLRLDFTEKFQPVVQLFD
DNGYVKDVEANFIVWEIHGRDDYSFNNTMAQSGCL
HEAQTWKSMIELNKHLPLEEVWGPEFL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.