Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405836 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Interferon gamma Receptor 2 (Interferon gamma Transducer 1) (IFNGR2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-IFNGR2 antibody: synthetic peptide directed towards the middle region of human IFNGR2
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
WEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQA
QLLWN KSNIFRVGHL- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Sirt2 interacts with 14-3-3 beta/gamma and down-regulates the activity of p53.
Jin YH, Kim YJ, Kim DW, Baek KH, Kang BY, Yeo CY, Lee KY
Biochemical and biophysical research communications 2008 Apr 11;368(3):690-5
Biochemical and biophysical research communications 2008 Apr 11;368(3):690-5
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting