Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28395 - Provider product page
- Provider
- Abnova Corporation
- Product name
- SNAP23 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant SNAP23.
- Antigen sequence
QINKDMRETEKTLTELNKCCGLCVCPCNRTKNFES
GKAYKTTWGDGGENSPCNVVSKQPGPVTNGQLQQP
TTGAASGGYIKRITNDAREDEMEENLTQVGSILGN
LKDMALNIGNEIDAQNPQIKRITDKADTNRDRIDI
ANA- Isotype
- IgG
- Storage
- Store at 4 °C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of lane 1: RT-4, lane 2: U-251 MG, lane 3: A-431, lane 4: Liver and lane 5: Tonsil using SNAP23 polyclonal antibody (Cat # PAB28395).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of U-2 OS cell line with SNAP23 polyclonal antibody (Cat # PAB28395) shows positivity in plasma membrane. Fixation/Permeabilization: PFA/Triton X-100
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human tonsil with SNAP23 polyclonal antibody (Cat # PAB28395) shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction center.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)