PAB20061

CTCFL antibody from Abnova Corporation
BORIS, CT27, dJ579F20.2

Antibody data

Product number
PAB20061
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20061, RRID:AB_10962610
Product name
CTCFL polyclonal antibody
Provider product page
Abnova Corporation - PAB20061
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant CTCFL.
Antigen sequence
DGVCREKDHRSPSELEAQRTSGAFQDSVLEEEVEL
VLAPSEESEKYILTLQTVHFTSEAVELQDMSLLSI
QQQEGVQVVVQQPGPGLLWLEEGPRQSLQQCVAIS
IQQELYSPQEMEVLQFHALEENVMVASEDSKLAVS
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -