Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310707 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Arginase, Liver (ARG1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ARG1 antibody: synthetic peptide directed towards the C terminal of human ARG1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine, Rabbit
- Host
- Rabbit
- Antigen sequence
LDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLA
REGNH KPIDYLNPPK- Vial size
- 0.1 mg
- Storage
- Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Submitted references Insights into the interaction of human liver arginase with tightly and weakly bound manganese ions by chemical modification and site-directed mutagenesis studies.
Orellana MS, López V, Uribe E, Fuentes M, Salas M, Carvajal N
Archives of biochemistry and biophysics 2002 Jul 15;403(2):155-9
Archives of biochemistry and biophysics 2002 Jul 15;403(2):155-9
No comments: Submit comment
No validations: Submit validation data