Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001637 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001637, RRID:AB_1080760
- Product name
- Anti-TJP1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ASSQPAKPTKVTLVKSRKNEEYGLRLASHIFVKEI
SQDSLAARDGNIQEGDVVLKINGTVTENMSLTDAK
TLIERSKGKLKMVVQRDERATLLNVPDLSDSIHSA
NASERDDISEIQSLASDHSGR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Cigarette smoke facilitates allergen penetration across respiratory epithelium
Sequential development of intercellular junctions in bioengineered human corneas
Gangl K, Reininger R, Bernhard D, Campana R, Pree I, Reisinger J, Kneidinger M, Kundi M, Dolznig H, Thurnher D, Valent P, Chen K, Vrtala S, Spitzauer S, Valenta R, Niederberger V
Allergy 2009 March;64(3):398-405
Allergy 2009 March;64(3):398-405
Sequential development of intercellular junctions in bioengineered human corneas
González-Andrades M, Garzón I, Gascón M, Muñoz-Ávila J, Sánchez-Quevedo M, Campos A, Alaminos M
Journal of Tissue Engineering and Regenerative Medicine 2009 August;3(6):442-449
Journal of Tissue Engineering and Regenerative Medicine 2009 August;3(6):442-449
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & cell junctions.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using Anti-TJP1 antibody. Corresponding TJP1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows distinct membranous and cytoplasmic positivity in cells of glomeruli.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows low expression as expected.
- Sample type
- HUMAN