Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA019462 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA019462, RRID:AB_1847595
- Product name
- Anti-DEFA6
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAE
DASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTV
MGINHRFC- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references REG gene expression in inflamed and healthy colon mucosa explored by in situ hybridisation.
Macaque paneth cells express lymphoid chemokine CXCL13 and other antimicrobial peptides not previously described as expressed in intestinal crypts.
Activation of REG family proteins in colitis.
van Beelen Granlund A, Østvik AE, Brenna Ø, Torp SH, Gustafsson BI, Sandvik AK
Cell and tissue research 2013 Jun;352(3):639-46
Cell and tissue research 2013 Jun;352(3):639-46
Macaque paneth cells express lymphoid chemokine CXCL13 and other antimicrobial peptides not previously described as expressed in intestinal crypts.
Lucero CM, Fallert Junecko B, Klamar CR, Sciullo LA, Berendam SJ, Cillo AR, Qin S, Sui Y, Sanghavi S, Murphey-Corb MA, Reinhart TA
Clinical and vaccine immunology : CVI 2013 Aug;20(8):1320-8
Clinical and vaccine immunology : CVI 2013 Aug;20(8):1320-8
Activation of REG family proteins in colitis.
Granlund Av, Beisvag V, Torp SH, Flatberg A, Kleveland PM, Ostvik AE, Waldum HL, Sandvik AK
Scandinavian journal of gastroenterology 2011 Nov;46(11):1316-23
Scandinavian journal of gastroenterology 2011 Nov;46(11):1316-23
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and DEFA6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419661).
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human small intestine and liver tissues using HPA019462 antibody. Corresponding DEFA6 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in a subset of glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human small intestine shows cytoplasmic positivity in Paneth cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum shows cytoplasmic positivity in Paneth cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.
- Sample type
- HUMAN