Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501706 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-V-Ets Erythroblastosis Virus E26 Oncogene Homolog 2 (Avian) (ETS2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ETS2 antibody: synthetic peptide directed towards the N terminal of human ETS2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
NDFGIKNMDQVAPVANSYRGTLKRQPAFDTFDGSL
FAVFP SLNEEQTLQE- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The role of the proto-oncogene ETS2 in acute megakaryocytic leukemia biology and therapy.
Ge Y, LaFiura KM, Dombkowski AA, Chen Q, Payton SG, Buck SA, Salagrama S, Diakiw AE, Matherly LH, Taub JW
Leukemia 2008 Mar;22(3):521-9
Leukemia 2008 Mar;22(3):521-9
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting