Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001912 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001912, RRID:AB_1080251
- Product name
- Anti-TFAP4
- Antibody type
- Polyclonal
- Reactivity
- Human, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
YFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLT
PETQRDQERRIRREIANSNERRRMQSINAGFQSLK
TLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLL
QQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDI
WEDEK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references AP4 is a mediator of epithelial-mesenchymal transition and metastasis in colorectal cancer.
Jackstadt R, Röh S, Neumann J, Jung P, Hoffmann R, Horst D, Berens C, Bornkamm GW, Kirchner T, Menssen A, Hermeking H
The Journal of experimental medicine 2013 Jul 1;210(7):1331-50
The Journal of experimental medicine 2013 Jul 1;210(7):1331-50
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-TFAP4 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & mitochondria.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows moderate nuclear positivity in exocrine glandular cells and islet cells.
- Sample type
- HUMAN