Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109610 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-IKAROS Family Zinc Finger 5 (Pegasus) (IKZF5) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNFN1A5 antibody: synthetic peptide directed towards the N terminal of human ZNFN1A5
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
MGEKKPEPLDFVKDFQEYLTQQTHHVNMISGSVSG
DKEAEALQGAGTDGD- Epitope
- N-Term
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Eos and pegasus, two members of the Ikaros family of proteins with distinct DNA binding activities.
Perdomo J, Holmes M, Chong B, Crossley M
The Journal of biological chemistry 2000 Dec 8;275(49):38347-54
The Journal of biological chemistry 2000 Dec 8;275(49):38347-54
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human muscle; WB Suggested Anti-ZNFN1A5 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human muscle; ZNFN1A5 antibody - N-terminal region (AP42189PU-N) in Human muscle cells using Western Blot
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Skin; ZNFN1A5 antibody - N-terminal region (AP42189PU-N) in Human Skin cells using Immunohistochemistry