AMAb90795

antibody from Atlas Antibodies

Targeting: SOX9 CMD1, CMPD1, SRA1

Western blot (Enhanced validation)

Immunocytochemistry (Supportive data in Antibodypedia)

Immunohistochemistry (Supportive data in Antibodypedia)

Antibody Data

Product number

AMAb90795

Provider

Atlas Antibodies

Proper citation

Atlas Antibodies Cat#AMAb90795, RRID:AB_2665670

Product name

Anti-SOX9

Antibody type

Monoclonal

Reactivity

Human, Mouse

Host

Mouse

Conjugate

Unconjugated

Antigen sequence

SQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLP
HYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTG
LYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQ
HWEQPVYTQLTR


Epitope

Binds to an epitope located within the peptide sequence SQRTHIKTEQLSPSH as determined by overlapping synthetic peptides.

Isotype

IgG

Antibody clone number

CL0639

Vial size

100 µl

Storage

Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Western blot

Enhanced validation

Submitted by

Atlas Antibodies (provider)

Enhanced method

Genetic validation

Main image

Experimental details

Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SOX9 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Lane 1: Marker [kDa]Lane 2:Human cell line U-251 MG

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Western blot analysis of extracts from U-251 cells, transfected with: control siRNA, target specific siRNA probe #1, target specific siRNA probe #2, using Anti-SOX9 monoclonal antibody. Downregulation of antibody signal confirms target specificity. Remaining % intensity, relative control lane, is indicated. Anti-GAPDH monoclonal antibody was used as loading control.

Immunocytochemistry

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of U-251 cells using the anti-SOX9 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).

Sample type

HUMAN

Immunohistochemistry

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human breast cancer shows strong nuclear immunoreactivity in tumor cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human ventricular cancer shows strong nuclear immunoreactivity in tumor cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human colorectal cancer shows moderate nuclear positivity in tumor cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human lung cancer shows nuclear positivity in tumor cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human stomach shows strong nuclear positivity in glandular cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human testis shows strong nuclear immunoreactivity in a subset of cells in seminiferous tubules.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human prostate shows strong nuclear immunoreactivity in glandular epithelial cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human liver shows absence of immunoreactivity (negative control).

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse embryo E14 shows nuclear immunoreactivity in the developing eye.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse embryo E11 shows nuclear positivity in the developing neural tube.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse embryo E11 shows nuclear immunoreactivity in the developing cartilage.