H00002999-B01

GZMH antibody from Abnova Corporation
CCP-X, CGL-2, CSP-C, CTLA1, CTSGL2

Antibody data

Product number
H00002999-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002999-B01, RRID:AB_913581
Product name
GZMH MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00002999-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human GZMH protein.
Antigen sequence
MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYM
AFVQFLQEKSRKRCGGILVRKDFVLTAAHCQGSSI
NVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNF
SNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQ
LCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERL
FHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKD
VAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKR
L
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -