Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001501-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001501-M01, RRID:AB_509086
- Product name
- CTNND2 monoclonal antibody (M01), clone 6E11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CTNND2.
- Antigen sequence
ISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTA
QNTGISTLYRNSYGAPAEDIKHNQVSAQPVPQEPS
RKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEY
TMHLG- Isotype
- IgG
- Antibody clone number
- 6E11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Identification of novel NPRAP/δ-catenin-interacting proteins and the direct association of NPRAP with dynamin 2.
Koutras C, Lévesque G
PloS one 2011;6(10):e25379
PloS one 2011;6(10):e25379
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CTNND2 monoclonal antibody (M01), clone 6E11 Western Blot analysis of CTNND2 expression in PC-12 ( Cat # L012V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CTNND2 monoclonal antibody (M01), clone 6E11. Western Blot analysis of CTNND2 expression in Raw 264.7.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CTNND2 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
