HPA019943

antibody from Atlas Antibodies

Targeting: CCAR2 DBC-1, DBC1, KIAA1967, NET35

Antibody data

Submit

Validation data

Product number: HPA019943 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA019943, RRID:AB_1852454
Product name: Anti-CCAR2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: RSVASNQSEMEFSSLQDMPKELDPSAVLPLDCLLA FVFFDANWCGYLHRRDLERILLTLGIRLSAEQAKQ LVSRVVTQNICQYRS
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CCAR2 protein structure - HPA019943 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and liver tissues using Anti-CCAR2 antibody. Corresponding CCAR2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human kidney, liver, pancreas and testis using Anti-CCAR2 antibody HPA019943 (A) shows similar protein distribution across tissues to independent antibody HPA019907 (B).
Antibody #2 product nr: HPA019907
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong nuclear positivity in renal tubules.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas using Anti-CCAR2 antibody HPA019943.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-CCAR2 antibody HPA019943.
Sample type: HUMAN