H00084529-B01P

C15orf41 antibody from Abnova Corporation
FLJ22851, HH114, MGC11326
No application information provided.

Antibody data

Product number
H00084529-B01P
Provider
Abnova Corporation
Product name
C15orf41 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00084529-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C15orf41 protein.
Antigen sequence
MARLILERFLQEHEETPPSKSIINSMLRDPSQIPD
GVLANQVYQCIVNDCCYGPLVDCIKHAIGHEHEVL
LRDLLLEKNLSFLDEDQLRAKGYDKTPDFILQVPV
AVEGHIIHWIESKASFGDECSHHAYLHDQFWSYWN
RFGPGLVIYWYGFIQELDCNRERGILLKACFPTNI
VTLCHSIA
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -